Basic usage¶
from pyhdx import read_dynamx, HDXMeasurement
from pyhdx.process import filter_peptides, apply_control, correct_d_uptake
from pyhdx.plot import peptide_coverage
import proplot as pplt
from pathlib import Path
C:\Users\jhsmi\Miniconda3\envs\py38_pyhdx_01\lib\site-packages\tqdm\auto.py:22: TqdmWarning: IProgress not found. Please update jupyter and ipywidgets. See https://ipywidgets.readthedocs.io/en/stable/user_install.html from .autonotebook import tqdm as notebook_tqdm
We can use the read_dynamx
function to read the input DynamX state file. In these fildes, exposure times in the .csv file are in units of minutes, which are converted to seconds using the time_conversion
argument.
Any space in column names are replaced with underscores and an additional column 'stop' is added, which is equal to 'end' + 1
such that python-standard inclusive: exclusive
interval indexing can be used.
This function returns a pandas
DataFrame where each entry corresponds to one peptide, in this example 567 peptides.
fpath = Path() / ".." / ".." / "tests" / "test_data" / "input" / "ecSecB_apo.csv"
data = read_dynamx(fpath, time_conversion=("min", "s"))
data.head()
protein | start | end | stop | sequence | modification | fragment | maxuptake | mhp | state | exposure | center | center_sd | uptake | uptake_sd | rt | rt_sd | |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
0 | Accession | 9 | 17 | 18 | MTFQIQRIY | NaN | NaN | 8 | 1199.6241 | Full deuteration control | 0.00 | 1200.412304 | 0.001798 | 0.000000 | 0.000000 | 5.510866 | 0.003846 |
1 | Accession | 9 | 17 | 18 | MTFQIQRIY | NaN | NaN | 8 | 1199.6241 | Full deuteration control | 10.02 | 1205.485704 | 0.019962 | 5.073400 | 0.020042 | 5.519758 | 0.002944 |
2 | Accession | 9 | 17 | 18 | MTFQIQRIY | NaN | NaN | 8 | 1199.6241 | SecB WT apo | 0.00 | 1200.411174 | 0.023301 | 0.000000 | 0.000000 | 5.513296 | 0.010889 |
3 | Accession | 9 | 17 | 18 | MTFQIQRIY | NaN | NaN | 8 | 1199.6241 | SecB WT apo | 10.02 | 1202.897618 | 0.016323 | 2.486444 | 0.028450 | 5.513900 | 0.010976 |
4 | Accession | 9 | 17 | 18 | MTFQIQRIY | NaN | NaN | 8 | 1199.6241 | SecB WT apo | 30.00 | 1203.268315 | 0.029992 | 2.857141 | 0.037979 | 5.510626 | 0.008419 |
This dataframe contains the peptides for both the fully deuterated control example as well as the experimental peptides measured over multiple deuterium exposure times. The filter_peptides
function can be used for to separate out peptides by their 'state' and 'exposure' fields.
# Filter out peptides for the full deuteration control
fd_df = filter_peptides(data, state="Full deuteration control", exposure=60 * 0.167)
fd_df["state"].unique(), fd_df["exposure"].unique()
(array(['Full deuteration control'], dtype=object), array([10.02]))
Additionally, the query
keyword argument can be used to pass a list of additional queries to be applied to the DataFrame. The query strings are passed to pandas.DataFrame.query and the example below removes all 0 exposure times peptides.
peptides = filter_peptides(data, state="SecB WT apo", query=["exposure > 0."])
peptides["state"].unique(), peptides["exposure"].unique()
(array(['SecB WT apo'], dtype=object), array([ 10.02 , 30. , 60. , 300. , 600. , 6000.00048]))
Next, the FD control is applied with the apply_control
function. This takes the intersection of peptides between the experimental and control peptides and subsequently adds the columns: 'fd_uptake', 'fd_uptake_sd', 'nd_uptake' , 'nd_uptake_sd', 'rfu' and 'rfu_sd'. The 'rfu' fields are Relative Fractional Uptake and are caluculated as:
$$ RFU = \frac{U(t) - ND }{FD - ND} $$
Where $U(t)$ are deuterium uptake values per peptide as a function of their D-exposure time. Supplying a Non-deuteration control is optional, and is otherwise assumed to be zero.
peptides_control = apply_control(peptides, fd_df, nd_control=None)
peptides_control.head()
start | end | stop | sequence | state | exposure | uptake | maxuptake | fd_uptake | fd_uptake_sd | ... | protein | modification | fragment | mhp | center | center_sd | uptake_sd | rt | rt_sd | rfu sd | |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
0 | 9 | 17 | 18 | MTFQIQRIY | SecB WT apo | 10.02 | 2.486444 | 8 | 5.0734 | 0.020042 | ... | Accession | NaN | NaN | 1199.6241 | 1202.897618 | 0.016323 | 0.028450 | 5.513900 | 0.010976 | 0.005932 |
1 | 9 | 17 | 18 | MTFQIQRIY | SecB WT apo | 30.00 | 2.857141 | 8 | 5.0734 | 0.020042 | ... | Accession | NaN | NaN | 1199.6241 | 1203.268315 | 0.029992 | 0.037979 | 5.510626 | 0.008419 | 0.007809 |
2 | 9 | 17 | 18 | MTFQIQRIY | SecB WT apo | 60.00 | 3.145738 | 8 | 5.0734 | 0.020042 | ... | Accession | NaN | NaN | 1199.6241 | 1203.556913 | 0.040432 | 0.046666 | 5.516562 | 0.012371 | 0.009519 |
3 | 9 | 17 | 18 | MTFQIQRIY | SecB WT apo | 300.00 | 3.785886 | 8 | 5.0734 | 0.020042 | ... | Accession | NaN | NaN | 1199.6241 | 1204.197061 | 0.008898 | 0.024942 | 5.505509 | 0.004363 | 0.005732 |
4 | 9 | 17 | 18 | MTFQIQRIY | SecB WT apo | 600.00 | 4.082950 | 8 | 5.0734 | 0.020042 | ... | Accession | NaN | NaN | 1199.6241 | 1204.494124 | 0.027490 | 0.036037 | 5.522181 | 0.011556 | 0.007782 |
5 rows × 23 columns
Next, the measured d-uptake is corrected for backexchange and the percentage of deuterium in solution. For this, the amount of N-terminal residues which are assumed to fully back exchange must be specified (typically best set to 2).
This step modified the 'sequence' field by marking back-exchanging amino acids with 'x', and adds the columns 'ex_residues', which is the total number of exchanging residues given back exchange, prolines and the percentage deuterium, and the column 'uptake_corrected', which is the final corrected D-uptake for the peptide.
peptides_corrected = correct_d_uptake(peptides_control, drop_first=2, d_percentage=90.0)
peptides_corrected.iloc[0]
start 9 end 17 stop 18 sequence xxFQIQRIY state SecB WT apo exposure 10.02 uptake 2.486444 maxuptake 8 fd_uptake 5.0734 fd_uptake_sd 0.020042 nd_uptake 0 nd_uptake_sd 0 rfu 0.490094 protein Accession modification NaN fragment NaN mhp 1199.6241 center 1202.897618 center_sd 0.016323 uptake_sd 0.02845 rt 5.5139 rt_sd 0.010976 rfu sd 0.005932 _sequence MTFQIQRIY _start 11 _stop 18 ex_residues 6.3 uptake_corrected 3.087594 Name: 0, dtype: object
This data array can now be used to create an HDXMeasurement
object, the main data object in PyHDX. Experimental metadata such as labelling pH and temperature (in Kelvin) can be specified. These quantities are required for calculating intrinsic exchange rates and ΔG values. The pH values are uncorrected values are measured by the pH meter (ie p(H, D) values)
sequence = "MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA"
temperature, pH = 273.15 + 30, 8.0
hdxm = HDXMeasurement(
peptides_corrected, sequence=sequence, pH=pH, temperature=temperature, name="My HDX measurement"
)
hdxm
HDX Measurement: My HDX measurement
Number of peptides: 63
Number of residues: 145 (11 - 156)
Number of timepoints: 6
Timepoints: 10.02, 30.00, 60.00, 300.00, 600.00, 6000.00 seconds
Coverage Percentage: 88.39
Average redundancy: 5.04
Average peptide length: 11.89
Repeatability (mean std): 0.05 Da
Temperature: 303.15 K
pH: 8.0
Iterating over a HDXMeasurement
object returns a set of HDXTimepoint
each with their own attributes describing the topology of the coverage. When creating the object, peptides which are not present in all timepoints are removed, such that all timepoints and HDXTimepoint
have identical coverage.
Note that the internal time units in PyHDX are seconds.
fig, ax = pplt.subplots(figsize=(10, 5))
i = 0
peptide_coverage(ax, hdxm[i].data, 20, cbar=True)
t = ax.set_title(f"Peptides t = {hdxm.timepoints[i]}")
l = ax.set_xlabel("Residue number")
fig, ax = pplt.subplots(figsize=(10, 5))
i = 4
peptide_coverage(ax, hdxm[i].data, 20, cbar=True)
t = ax.set_title(f"Peptides t = {hdxm.timepoints[i]}")
l = ax.set_xlabel("Residue number")
The data in an HDXMeasurement
object can be saved to and reloaded from disk (with associated metadata)
in .csv format.
from pyhdx.fileIO import csv_to_hdxm
hdxm.to_file("My_HDX_file.csv")
hdx_load = csv_to_hdxm("My_HDX_file.csv")
hdx_load
HDX Measurement: My HDX measurement
Number of peptides: 63
Number of residues: 145 (11 - 156)
Number of timepoints: 6
Timepoints: 10.02, 30.00, 60.00, 300.00, 600.00, 6000.00 seconds
Coverage Percentage: 88.39
Average redundancy: 5.04
Average peptide length: 11.89
Repeatability (mean std): 0.05 Da
Temperature: 303.15 K
pH: 8.0